Loading...
Statistics
Advertisement

Finbrosent.com

Advertisement
Conversion Technology Metas Server
Finbrosent.com is hosted in Switzerland . Finbrosent.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Finbrosent.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Finbrosent.com

Missing HTTPS protocol.

    Meta - Finbrosent.com

    Number of occurences: 0

    Server / Hosting

    • IP: 141.8.224.93
    • Latitude: 47.14
    • Longitude: 8.16
    • Country: Switzerland

    Rname

    • ns7.rookdns.com
    • ns8.rookdns.com

    Target

    • rmgdns111.gmail.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 05 Oct 2016 20:45:05 GMT Server: Apache Set-Cookie: gvc=904vr2232459052517685; expires=Mon, 04-Oct-2021 20:45:05 GMT; path=/; domain=www.finbrosent.com; httponly Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAKrfIMFkSaoTSqKmC+BrghK0CpDHc0MuVzmMHin8LIORhpXbped+iYhSnZurWnEO0zcKcVIrzp026LVc5pMB9bUCAwEAAQ==_MjVkxHGVghQJf87NBTuzm81cVXZave6N00dAVbkn9jmRFv4OFQmPdvfVB9PeHjA50+c18sQVvTVx7UGQGALX4w== Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1202 Transfer-Encoding: chunked Via: 1.1 s_wx1202 (squid/3.5.20) Connection: keep-alive

    DNS

    host: finbrosent.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 141.8.224.93
    host: finbrosent.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns7.rookdns.com
    host: finbrosent.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns8.rookdns.com
    host: finbrosent.com
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: ns7.rookdns.com
    5. rname: rmgdns111.gmail.com
    6. serial: 2011101001
    7. refresh: 3600
    8. retry: 900
    9. expire: 604800
    10. minimum-ttl: 86400
    host: finbrosent.com
    1. class: IN
    2. ttl: 300
    3. type: PTR
    4. target: ns7.rookdns.com
    host: finbrosent.com
    1. class: IN
    2. ttl: 300
    3. type: TXT
    4. txt: v=spf1 a -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.inbrosent.com, www.fqinbrosent.com, www.qinbrosent.com, www.finbrosent.com, www.inbrosent.com, www.fainbrosent.com, www.ainbrosent.com, www.fyinbrosent.com, www.yinbrosent.com, www.ftinbrosent.com, www.tinbrosent.com, www.fginbrosent.com, www.ginbrosent.com, www.fbinbrosent.com, www.binbrosent.com, www.fwinbrosent.com, www.winbrosent.com, www.fsinbrosent.com, www.sinbrosent.com, www.fdinbrosent.com, www.dinbrosent.com, www.frinbrosent.com, www.rinbrosent.com, www.f3inbrosent.com, www.3inbrosent.com, www.f4inbrosent.com, www.4inbrosent.com, www.fnbrosent.com, www.firnbrosent.com, www.frnbrosent.com, www.fifnbrosent.com, www.ffnbrosent.com, www.fivnbrosent.com, www.fvnbrosent.com, www.fiknbrosent.com, www.fknbrosent.com, www.fi,nbrosent.com, www.f,nbrosent.com, www.fibnbrosent.com, www.fbnbrosent.com, www.fignbrosent.com, www.fgnbrosent.com, www.fitnbrosent.com, www.ftnbrosent.com, www.fiynbrosent.com, www.fynbrosent.com, www.fiunbrosent.com, www.funbrosent.com, www.fijnbrosent.com, www.fjnbrosent.com, www.fimnbrosent.com, www.fmnbrosent.com, www.finnbrosent.com, www.fnnbrosent.com, www.fibrosent.com, www.finnbrosent.com, www.finbrosent.com, www.finhbrosent.com, www.fihbrosent.com, www.finjbrosent.com, www.fijbrosent.com, www.finkbrosent.com, www.fikbrosent.com, www.finlbrosent.com, www.filbrosent.com, www.fin brosent.com, www.fi brosent.com, www.finrosent.com, www.finbqrosent.com, www.finqrosent.com, www.finbwrosent.com, www.finwrosent.com, www.finbzrosent.com, www.finzrosent.com, www.finbxrosent.com, www.finxrosent.com, www.finbrosent.com, www.finrosent.com, www.finbsrosent.com, www.finsrosent.com, www.finbyrosent.com, www.finyrosent.com, www.finberosent.com, www.finerosent.com, www.finbdrosent.com, www.findrosent.com, www.finbcrosent.com, www.fincrosent.com, www.finbosent.com, www.finbriosent.com, www.finbiosent.com, www.finbroosent.com, www.finboosent.com, www.finbrlosent.com, www.finblosent.com, www.finbrlosent.com, www.finblosent.com, www.finbr.osent.com, www.finb.osent.com, www.finbrsent.com, www.finbrobsent.com, www.finbrbsent.com, www.finbrohsent.com, www.finbrhsent.com, www.finbrogsent.com, www.finbrgsent.com, www.finbrojsent.com, www.finbrjsent.com, www.finbromsent.com, www.finbrmsent.com, www.finbro sent.com, www.finbr sent.com, www.finbrovsent.com, www.finbrvsent.com, www.finbroent.com, www.finbroseent.com, www.finbroeent.com, www.finbroswent.com, www.finbrowent.com, www.finbrosdent.com, www.finbrodent.com, www.finbrosxent.com, www.finbroxent.com, www.finbrosfent.com, www.finbrofent.com, www.finbrosgent.com, www.finbrogent.com, www.finbrostent.com, www.finbrotent.com, www.finbrosnt.com, www.finbrosxnt.com, www.finbrosesnt.com, www.finbrossnt.com, www.finbrosewnt.com, www.finbroswnt.com, www.finbrosernt.com, www.finbrosrnt.com, www.finbrosefnt.com, www.finbrosfnt.com, www.finbrosevnt.com, www.finbrosvnt.com, www.finbrosecnt.com, www.finbroscnt.com, www.finbroseqnt.com, www.finbrosqnt.com, www.finbroseant.com, www.finbrosant.com, www.finbroseynt.com, www.finbrosynt.com, www.finbroset.com, www.finbrosennt.com, www.finbrosent.com, www.finbrosenht.com, www.finbroseht.com, www.finbrosenjt.com, www.finbrosejt.com, www.finbrosenkt.com, www.finbrosekt.com, www.finbrosenlt.com, www.finbroselt.com, www.finbrosen t.com, www.finbrose t.com,

    Other websites we recently analyzed

    1. So Cal Bengals | Home of the Southern California Bengals
      Scottsdale (United States) - 50.63.100.1
      Server software: Apache
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Wordpress
      Number of Javascript: 32
      Number of meta tags: 4
    2. dandashahbilawal.xyz
      Cheyenne (United States) - 167.88.160.183
      Server software: LiteSpeed
      Technology: CSS, Html
      Number of meta tags: 3
    3. Koren Helbig | Australian freelance journalist in Spain
      I'm an Australian freelance journalist, writer and blogger based in Spain, writing stories about passionate people doing good in the world.
      Provo (United States) - 66.147.244.144
      Server software: nginx/1.10.1
      Technology: CSS, Gravatar, Html, Javascript, jQuery, Lightbox, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 9
      Number of meta tags: 6
    4. Up2Eleven Consulting – "Whats going on in that mind of yours……"
      Scottsdale (United States) - 192.186.242.96
      Server software: Apache/2.4.23
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Colorbox, Php, Pingback, Wordpress
      Number of Javascript: 15
      Number of meta tags: 3
    5. Instant Cashflow Membership Program
      Complete Video Based Membership Site
      Lansing (United States) - 72.52.226.70
      Server software: Apache
      Technology: CSS, Html, Iframe
      Number of meta tags: 4
    6. Infinity Shoes
      Canada - 23.227.38.69
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, Php, SVG, Shopify
      Number of Javascript: 5
      Number of meta tags: 4
    7. netzwerkorange - Web Development
      netzwerkorange is Thomas Gensicke, a freelancing web developer from Berlin, Germany.
      Germany - 80.67.17.118
      Server software: Apache/2.4.20
      Technology: CSS, Html, Html5, Iframe
      Number of Javascript: 2
      Number of meta tags: 3
    8. Tutkryto.NET | У нас всегда весело :) | Ещё один сайт на WordPress
      TutKryto - С намы всегда круто...
      Moscow (Russian Federation) - 82.146.32.59
      G Analytics ID: UA-68658187-1
      Server software: Apache/2.2.22 (@RELEASE@)
      Technology: CSS, Flexslider, Font Awesome, Html, Html5, Iframe, Javascript, jQuery, jQuery Cycle, Php, Pingback, Google Analytics, LiveInternet counter, Wordpress, Facebook Like box, Facebook Box
      Number of Javascript: 16
      Number of meta tags: 6
    9. mtpleasantcriminaldefenselawyer.com
      Scottsdale (United States) - 50.63.202.57
      Server software: squid/3.5.19
      Technology: Html, Html5, Iframe
    10. All Are Called...
      Jacksonville (United States) - 206.188.192.202
      Server software: Apache
      Technology: CSS, Html
      Number of Javascript: 3
      Number of meta tags: 2

    Check Other Websites